SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), GFP/His-Tag

$505.00 $565.00 Save $60

Shipping calculated at checkout

trenzyme SKU: P2020-046_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (L452R-E484Q) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The mutations L452R-E484Q are characteristic for the fast spreading SARS-CoV-2 virus variants B.1.617 emerged in India. These mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor, which results in increased transmissibility of the SARS-CoV-2 virus.

trenzyme cellebrity kolben
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (L452R, E484Q)), GFP/His-Tag
  • Catalog No.: P2020-046
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (E484Q, L452R); 501.V2; VUI-202012/01; B.1.617; B1617; B.1.617.1; B16171; B.1.617.2; B16172; B.1.617.3; B16173; Indian Variant; ; E484Q; L452R
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFST
    FKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAW
    NSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVQGFNCYFPLQSYG
    FQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and E484Q of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant L452R, E484Q, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant L452R, E484Q, GFP/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.