SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), GFP/His-Tag

• Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), GFP/His-Tag
• Catalog No.: P2020-031
• RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
• Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
• Tags: His-Tag, N-terminal and GFP+His-Tag, C-terminal
• Sequence without tags (AA 319-541):
  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
  DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
  STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  

• Expression Host: human, HEK293
• Formulation: PBS, pH 7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.

Time-dependent binding of wild-type spike RBD to the membrane of ACE2 overexpressing cells	Binding of wild-type spike RBD to the membrane of ACE2 overexpressing cells
Time dependence of binding of 5 µg/ml wild-type spike RBD-GFP to the membrane of ACE2 overexpressing cells (data after 5, 10, 20 and 30 minutes of labeling are shown) Data provided by Kovacs T., Nagy P., Panyi G. and Zakany F., Department of Biophysics and Cell Biology, University of Debrecen, Hungary	Data obtained after 30 minutes of labeling at different wild-type spike RBD-GFP concentrations (0.2, 1 and 5 µg/ml) Data provided by Kovacs T., Nagy P., Panyi G. and Zakany F., Department of Biophysics and Cell Biology, University of Debrecen, Hungary
SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD), GFP/His-Tag

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.