SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation

$319.00 $354.00 Save $35

Shipping calculated at checkout

trenzyme SKU: P2020-001_100

Only 7 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag, liquid formulation.

trenzyme cellebrity kolben
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation
  • Catalog No.: P2020-001
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
    QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.


SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry

SARS-CoV-2 Spike S1 (RBD) is highly pure and forms stable monomers of 28 kDa as verified by SEC

hACE2 Biolayer Interferometry graph diagram
Determination of elution profile by absorbance at 289 nm (blue line)

Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), Tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-Tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model.
Device: Octet RED96e, ForteBio.

Size exclusion chromatography (SEC) of purified SARS-CoV-2 Spike S1 (RBD), His-Tag protein, determination of elution profile by absorbance at 280 nm (blue line).

 

Analysis of released N-glycans by HILIC

Activity of SARS-CoV-2 S1(RBD)

Fluorescence chromatogram
Activity of SARS-CoV-2 S1 (RBD)

Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG).

Activity of different SARS-CoV-2 S1(RBD) lots was determined using a Sandwich-ELISA with antibodies from Sino Biological Europe GmbH (coat: #40150-D003 and detection: #40150-D001-H).

Stability during storage at 4°C

Stability during storage at 4°C

Stability during storage at 4°C determined by functional ELISA (binding to hACE2 (ECD) – Cat# P2020-016; detection by mAb CR3022).

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE/Coll. Coomassie
Histogram of marked lane in gel picture

The table below lists publications that mention this catalog protein.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
15 September 2021 Ultra-sensitive and fast optical detection of the spike protein of the SARS-CoV-2 using AgNPs/SiNWs nanohybrid based sensors Kais Daoudi, Krithikadevi Ramachandran, Hussain Alawadhi, Rabah Boukherroub, Elhadj Dogheche, et al. Severe acute respiratory syndrome SARS-CoV-2 virus led to notable challenges amongst researchers in view of development of new and fast detecting techniques. In this regard, surface-enhanced Raman spectroscopy (SERS) technique, providing a fingerprint characteristic for each material, would be an interesting approach. The current study encompasses ... read more https://doi.org/10.1016/j.surfin.2021.101454
17 December 2021 Development and validation of novel kit for quantification of SARS-CoV-2 antibodies on clinical samples Sneha Kumari, Anoushka Raina, Dinesh Chandra, Nikita Gupta, Nikki Dey, et al. Since the pandemic occurred due to the emergence of SARS-CoV-2, there has always been a demand for a simple and sensitive diagnostic kit for detection of SARS-Cov-2 infection. In January 2020, WHO approved… read more https://doi.org/10.1016/j.jviromet.2021.114423
20 December 2021 Persistence of functional memory B cells recognizing SARS-CoV-2 variants despite loss of specific IgG Stephan Winklmeier, Katharina Eisenhut, Damla Taskin, Heike Rübsamen, Ramona Gerhards, Celine Schneider, et al. Although some COVID-19 patients maintain SARS-CoV-2-specific serum immunoglobulin G (IgG) for more than 6 months postinfection, others eventually lose IgG levels. We assessed the persistence of SARS-CoV-2-specific B cells in 17 patients, 5 of whom had lost specific IgGs after 5–8 months. Differentiation of blood-derived B cells ... read more https://doi.org/10.1016/j.isci.2021.103659
10 February 2023 Impedimetric Nanobiosensor for the Detection of SARS-CoV-2 Antigens and Antibodies Diana Isabel Sandoval Bojórquez, Željko Janićijević, Brenda Palestina Romero, Eduardo Sergio Oliveros Mata, Markus Laube, Anja Feldmann, et al. Detection of antigens and antibodies (Abs) is of great importance in determining the infection and immunity status of the population, as they are key parameters guiding the handling of pandemics. Current point-of-care (POC) devices are a convenient option for rapid screening; however, their sensitivity requires further improvement. We present an interdigitated gold nanowire-based impedance nanobiosensor to detect COVID-19-associated antigens (receptor-binding domain of S1 protein of the SARS-CoV-2 virus) and... read more https://doi.org/10.1021/acssensors.2c01686
17 February 2023 Continuous population-level monitoring of SARS-CoV-2 seroprevalence in a large European metropolitan region Marc Emmenegger, Elena De Cecco, David Lamparter, Raphaël P.B. Jacquat, Julien Riou, Dominik Menges et al. Effective public health measures against SARS-CoV-2 require granular knowledge of population-level immune responses. We developed a Tripartite Automated Blood Immunoassay (TRABI) to assess the IgG response against three SARS-CoV-2 proteins. We used TRABI for continuous seromonitoring of hospital ... read more https://doi.org/10.1016/j.isci.2023.105928
21 March 2023 Novel intranasal vaccine targeting SARS-CoV-2 receptor binding domain to mucosal microfold cells and adjuvanted with TLR3 agonist Riboxxim™ elicits strong antibody and T-cell responses in mice Reinhold Horlacher, Armin Günther, Alexander Brosig, Jenny Morath, Barbara Jakobs, Marcus Groettrup, et al. SARS-CoV-2 continues to circulate in the human population necessitating regular booster immunization for its long-term control. Ideally, vaccines should ideally not only protect against symptomatic disease, but also prevent transmission via asymptomatic shedding and cover existing and future variants of the virus. This may ultimately only be possible through induction of potent and long-lasting immune... read more https://doi.org/10.1038/s41598-023-31198-3

 

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.