SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free

$212.00 $236.00 Save $24

Shipping calculated at checkout

trenzyme SKU: P2020-022_100

Only 5 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus, no affinity Tags or other artificial sequences present.

Preclinical Version available on request: includes additional QC and more data

trenzyme cellebrity kolben
  • Product Name: SARS-CoV-2 (COVID 19) Spike S1 Protein (RBD), Tag-free
  • Catalog No.: P2020-022
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: Tag-free
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
    DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
    STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  • Expression Host: CHO
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 90% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.


S1(RBD) with and without His-Tag are active.

RBD (Tag-free) binds ACE2 detected by monoclonal antibody CR3022 (conformational antibody).

SARS-CoV-2-Spike-S1 ELISA-1 S1(RBD) with and without His-Tag are active
RBD (Tag-free) binds ACE2 detected by monoclonal antibody CR3022 (conformational antibody)

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 Spike S1 Tag-free
SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free Histogram

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
28 November 2022 High antibody levels and reduced cellular response in children up to one year after SARS-CoV-2 infection Eva-Maria Jacobsen, Dorit Fabricius, Magdalena Class, Fernando Topfstedt, Raquel Lorenzetti, Iga Janowska, et al. The COVID-19 course and immunity differ in children and adults. We analyzed immune response dynamics in 28 families up to 12 months after mild or asymptomatic infection. Unlike adults, the initial response is plasmablast-driven in children. Four months after infection, children show an enhanced specific antibody response and lower but detectable spike 1 protein (S1)-specific B and T cell ... read more https://doi.org/10.1038/s41467-022-35055-1

 

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.