blueTEV Cleavage Kit

$397.00 $491.00 Save $94

Shipping calculated at checkout

trenzyme SKU: P2020-CK3

Available Now!

Kit: 1KU blueTEV + Cleavage and tag control protein

Need a quote for an individual request or for a bulk order? Please contact us

Description

Including

    Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein. TEV cleavage results in two cleavage products of 42.8 kDa and 47.7 kDa.
    The optimized blueTEV protease and the Cleavage and tag control protein are also available separately.

    blueTEV is an optimized TEV protease (Tobacco Etch Virus Protease) fused to a BFP protein. blueTEV contains a His-Tag to facilitate the removal of the protease from the cleavage reaction after completion of cleavage. The removal of blueTEV can be monitored easily by following the fluorescence - this easy, fast and sensitive method omits time-consuming SDS-PAGE or Western blot analysis. The recognition sequence with the highest catalytic activity is ENLYFQ(G/S).

    trenzyme cellebrity kolben
    • Product Name: blueTEV & Cleavage and tag control protein
    • Catalog No.: P2020-CK3 / CK4
    • RefSeq Links: UniProt: Q0GDU8
    • Synonyms: TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; P1 protease; EC 3.4.22.44; control protein, reference protein, cleavage control protein, multiple tag control protein, universal reference protein
    • Species: Tobaco Etch Virus / artificial
    • Tags: 
      blueTEV: BFP, N-terminal and His-Tag, C-terminal
      Cleavage and tag control protein: Twin-Strep, HA, T7, Avi, FLAG, and His-tag; N-terminal MBP and C-terminal sfGFP fusion
    • Sequence blueTEV without tags (AA 5-236):
      KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK
      VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV
      SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN
      FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
    • Expression Host: E. coli
    • Formulation: 
      blueTEV: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose; pH 8.0
      Cleavage and tag control protein: PBS; pH 7.4
    • Format: Lyophilized, stored at -80 °C preferred (-20° C possible) and shipped at ambient temperature
    • Purity: > 85% as determined by SDS-PAGE
    • Activity blueTEV: ≥ 20 Units/µl (determined by cleavage of control protein)
      ≥ 0.25 µmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit (Abcam))
    • Unit definition blueTEV: One unit of blueTEV cleaves > 85 % of 3 µg of a fusion protein in 1 hour at room temperature. Cleavage overnight increases cleavage efficiency to > 99 %. It is recommended to optimize cleavage conditions for each protein by varying the amount of blueTEV, reaction time, or temperature.

    blueTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. "blue" indicates fusion of the protease to blue fluorescent protein (BFP), which leads to increased stability and solubility of TEV protease. Moreover, blueTEV has been optimized by site directed mutagenesis to prevent autocatalytic cleavage. blueTEV is a highly site-specific cysteine protease that recognizes the amino acid sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleaves between the residues Gln and Gly/Ser. The most commonly used recognition sequence is ENLYFQG. In biotechnology, blueTEV is a versatile enzyme to remove affinity tags from recombinant proteins with high specificity and activity over a wide range of pH, ionic strength and temperatures between 4 °C and 30 °C. The optimal temperature for cleavage is 30 °C. It is recommended to improve cleavage efficiency for each fusion protein by varying the amount of recombinant blueTEV, reaction time, or incubation temperature. The great advantage of blueTEV is its facile removal after cleavage reaction by immobilized metal affinity chromatography (IMAC) since it is equipped with a His-tag. Furthermore, the removal of blueTEV can be monitored instantly by detection of fluorescence in solution - this easy, fast and sensitive method omits time-consuming SDS-PAGE or Western blot analysis.

    The Cleavage and tag control protein is a versatile protein consisting of various cleavage sites for proteases including TEV, Enterokinase, Thrombin, Factor Xa and PreScission™. Protease cleavage results in generation of two or three fragments that have significantly reduced molecular weights, which are as follows:
    - TEV cleavage: 42.8 kDa and 47.7 kDa
    - Enterokinase: 43.5 kDa, 20.1 kDa and 26.9 kDa
    - Thrombin: 43.9 kDa and 46.6 kDa
    - Factor Xa: 44.3 kDa and 46.2 kDa
    - PreScission™: 45.3 kDa and 45.3 kDa
    Moreover, the 90.5 kDa fusion protein is equipped with multiple tags such as Twin-Strep-, HA-, FLAG-, and His-tag, for instance, that may serve as positive control performing specific Western blot analyses or any functional assay. Since the protein is fused to GFP, it is additionally applicable as fluorescence control. Thus, the cleavage and tag control protein provides an excellent tool to monitor protease cleavage reactions and specific Western blot analyses as well as fluorescence experiments.

    Additional Information blueTEV

    SDS-PAGE/Coll. Coomassie

    Histogram of marked lane in gel picture

    SDS Page of blueTEV lyophilized Histogram of blueTEV lyophilized

    Test Cleavage

    Description of Test Cleavage

    Test Cleavage of blueTEV
    Test Cleavage Description

    Additional Information Cleavage and tag control protein

    SDS-PAGE/Coll. Coomassie

    Histogram of marked lane in gel picture

    SDS Page of Cleavage and tag control protein
    Histogram of Cleavage and tag control protein

    Test Cleavage

    Description of Test Cleavage

    Test Cleavage of Cleavage and tag control protein
    Test Cleavage Description of Cleavage and tag control protein

    Test Cleavage

    Description for Test Cleavage

    Test Cleavage of Cleavage and tag control protein
    Test Cleavage Description of Cleavage and tag control protein

    Get in contact with us


    By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.